AIFM3 anticorps (Middle Region)
-
- Antigène Voir toutes AIFM3 Anticorps
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AIFM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AIFM3 antibody was raised against the middle region of AIFM3
- Purification
- Affinity purified
- Immunogène
- AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
- Top Product
- Discover our top product AIFM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
- Autre désignation
- AIFM3 (AIFM3 Produits)
- Synonymes
- anticorps nfrl-A, anticorps MGC84340, anticorps AIFM3, anticorps LOC100150876, anticorps 2810401C16Rik, anticorps AI840249, anticorps Aifl, anticorps RGD1306028, anticorps AIFL, anticorps apoptosis inducing factor, mitochondria associated 3 L homeolog, anticorps apoptosis inducing factor, mitochondria associated 3, anticorps apoptosis-inducing factor, mitochondrion-associated 3, anticorps aifm3.L, anticorps AIFM3, anticorps aifm3, anticorps Aifm3
- Sujet
- AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis
-