TTL anticorps (Middle Region)

N° du produit ABIN631103

Détail du produit anti-TTL anticorps

Antigène: TTL (Tubulin tyrosine Ligase (TTL))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTL est non-conjugé

Application: Western Blotting (WB)

Specificité: TTL antibody was raised against the middle region of TTL

Purification: Affinity purified

Immunogène: TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTL Blocking Peptide, catalog no. 33R-5571, is also available for use as a blocking control in assays to test for specificity of this TTL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTL

Antigène: TTL (Tubulin tyrosine Ligase (TTL))

Autre désignation: TTL (TTL Produits)

Synonymes: anticorps 2410003M22Rik, anticorps 2700049H19Rik, anticorps AI848570, anticorps wu:fb93a09, anticorps zgc:153332, anticorps tubulin tyrosine ligase, anticorps Ttl, anticorps TTL, anticorps ttl

Sujet: TTL catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Regulation of Cell Size