NR1I3 anticorps (Middle Region)

N° du produit ABIN631114

Détail du produit anti-NR1I3 anticorps

Antigène: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR1I3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR1 I3 antibody was raised against the middle region of NR1 3

Purification: Affinity purified

Immunogène: NR1 I3 antibody was raised using the middle region of NR1 3 corresponding to a region with amino acids PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR1I3 Blocking Peptide, catalog no. 33R-7407, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR1I3

Antigène: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Autre désignation: NR1I3 (NR1I3 Produits)

Synonymes: anticorps AA209988, anticorps AI551208, anticorps CAR, anticorps CAR-beta, anticorps Care2, anticorps ESTM32, anticorps MB67, anticorps CAR1, anticorps CXR, anticorps nuclear receptor subfamily 1 group I member 3, anticorps nuclear receptor subfamily 1, group I, member 3, anticorps NR1I3, anticorps Nr1i3

Sujet: NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway