HAX1 anticorps (Middle Region)

N° du produit ABIN631118

Détail du produit anti-HAX1 anticorps

Antigène: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HAX1 antibody was raised against the middle region of HAX1

Purification: Affinity purified

Immunogène: HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAX1 Blocking Peptide, catalog no. 33R-7672, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAX1

Antigène: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Autre désignation: HAX1 (HAX1 Produits)

Synonymes: anticorps HAX1, anticorps hax1, anticorps HCLSBP1, anticorps HS1BP1, anticorps SCN3, anticorps HAX-1, anticorps Hs1bp1, anticorps HSP1BP-1, anticorps SIG-111, anticorps Silg111, anticorps mHAX-1s, anticorps HCLS1 associated protein X-1, anticorps HCLS1 associated X-1, anticorps HAX1, anticorps hax1, anticorps Hax1

Sujet: HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization