HAX1 anticorps (Middle Region)
-
- Antigène Voir toutes HAX1 Anticorps
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HAX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HAX1 antibody was raised against the middle region of HAX1
- Purification
- Affinity purified
- Immunogène
- HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
- Top Product
- Discover our top product HAX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HAX1 Blocking Peptide, catalog no. 33R-5266, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
- Autre désignation
- HAX1 (HAX1 Produits)
- Synonymes
- anticorps HAX1, anticorps hax1, anticorps HCLSBP1, anticorps HS1BP1, anticorps SCN3, anticorps HAX-1, anticorps Hs1bp1, anticorps HSP1BP-1, anticorps SIG-111, anticorps Silg111, anticorps mHAX-1s, anticorps HCLS1 associated protein X-1, anticorps HCLS1 associated X-1, anticorps HAX1, anticorps hax1, anticorps Hax1
- Sujet
- HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-