Arrestin 3 anticorps (Middle Region)

N° du produit ABIN631132

Détail du produit anti-Arrestin 3 anticorps

Antigène: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Arrestin 3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Arrestin B2 antibody was raised against the middle region of ARRB2

Purification: Affinity purified

Immunogène: Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Arrestin B2 Blocking Peptide, catalog no. 33R-8056, is also available for use as a blocking control in assays to test for specificity of this Arrestin B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Arrestin 3

Antigène: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Abstract: ARRB2 Produits

Synonymes: anticorps ARRB2, anticorps arb2, anticorps arr2, anticorps arrestin, anticorps barr2, anticorps betaarr2, anticorps ARB2, anticorps ARR2, anticorps BARR2, anticorps BARRES, anticorps AI326910, anticorps AW122872, anticorps arrb2, anticorps zgc:64007, anticorps arrestin beta 2, anticorps arrestin, beta 2, anticorps arrestin beta 2 L homeolog, anticorps arrestin, beta 2b, anticorps ARRB2, anticorps arrb2, anticorps Arrb2, anticorps arrb2.L, anticorps arrb2b

Sujet: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling