EGLN3 anticorps

N° du produit ABIN631137

Détail du produit anti-EGLN3 anticorps

Antigène: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EGLN3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EGLN3 Blocking Peptide, catalog no. 33R-3129, is also available for use as a blocking control in assays to test for specificity of this EGLN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EGLN3

Antigène: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Autre désignation: EGLN3 (EGLN3 Produits)

Synonymes: anticorps zgc:77019, anticorps wu:fj78a08, anticorps EGLN3, anticorps phd3, anticorps PHD-3, anticorps PHD3, anticorps SM-20, anticorps 2610021G09Rik, anticorps AI505553, anticorps AI648162, anticorps Hif-p4h-3, anticorps Phd3, anticorps HIFP4H3, anticorps HIFPH3, anticorps egl-9 family hypoxia-inducible factor 3, anticorps egl-9 family hypoxia inducible factor 3, anticorps egl-9 family hypoxia-inducible factor 3 L homeolog, anticorps egln3, anticorps EGLN3, anticorps egln3.L, anticorps Egln3

Sujet: EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-564', and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity