DYNLL1 anticorps (Middle Region)
-
- Antigène Voir toutes DYNLL1 Anticorps
- DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DYNLL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DYNLL1 antibody was raised against the middle region of DYNLL1
- Purification
- Affinity purified
- Immunogène
- DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
- Top Product
- Discover our top product DYNLL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DYNLL1 Blocking Peptide, catalog no. 33R-2498, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))
- Autre désignation
- DYNLL1 (DYNLL1 Produits)
- Synonymes
- anticorps DLC1, anticorps DLC8, anticorps DNCL1, anticorps DNCLC1, anticorps LC8, anticorps LC8a, anticorps PIN, anticorps hdlc1, anticorps dynll2, anticorps wu:fd56c09, anticorps zgc:73406, anticorps Dlc8, anticorps Dnclc1, anticorps Pin, anticorps 8kDLC, anticorps lc8, anticorps dlc1, anticorps dlc8, anticorps lc8a, anticorps dncl1, anticorps dnclc1, anticorps dynll1a, anticorps MGC68763, anticorps CDLC2, anticorps dynll1, anticorps dynll1b, anticorps pin, anticorps MGC89636, anticorps dynein light chain LC8-type 1, anticorps dynein, light chain, LC8-type 1, anticorps dynein light chain LC8-type 1 S homeolog, anticorps dynein light chain LC8-type 1 L homeolog, anticorps Dynein light chain 1, cytoplasmic, anticorps DYNLL1, anticorps dynll1, anticorps Dynll1, anticorps dynll1.S, anticorps dynll1.L, anticorps dlc-1
- Sujet
- Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains.
- Poids moléculaire
- 10 kDa (MW of target protein)
- Pathways
- M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity
-