IFT122 anticorps

N° du produit ABIN631200

Détail du produit anti-IFT122 anticorps

Antigène: IFT122 (Intraflagellar Transport 122 (IFT122))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFT122 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFT122 Blocking Peptide, catalog no. 33R-7457, is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFT122

Antigène: IFT122 (Intraflagellar Transport 122 (IFT122))

Autre désignation: IFT122 (IFT122 Produits)

Synonymes: anticorps C86139, anticorps Wdr10, anticorps sopb, anticorps CED, anticorps CED1, anticorps SPG, anticorps WDR10, anticorps WDR10p, anticorps WDR140, anticorps intraflagellar transport 122, anticorps intraflagellar transport protein 122 homolog, anticorps IFT122, anticorps ift122, anticorps LOC100639275, anticorps LOC100649523, anticorps Ift122

Sujet: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Poids moléculaire: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis