IFT122 anticorps

N° du produit ABIN631200

Cet anticorps anti-IFT122 Polyclonal Lapin (ABIN631200) détecte spécifiquement IFT122 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour IFT122 anticorps (ABIN631200)

Antigène: IFT122 (Intraflagellar Transport 122 (IFT122))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFT122 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFT122 anticorps

Purification: Affinity purified

Immunogène: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFT122 Blocking Peptide, (ABIN5614150), is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFT122

Antigène: IFT122 (Intraflagellar Transport 122 (IFT122))

Autre désignation: IFT122

Sujet: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Poids moléculaire: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis