MAP2K3 anticorps (C-Term)

N° du produit ABIN631258

Cet anticorps Lapin Polyclonal détecte spécifiquement MAP2K3 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MAP2K3 anticorps (C-Term) (ABIN631258)

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP2K3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP2K3 anticorps

Épitope: C-Term

Specificité: MAP2 K3 antibody was raised against the C terminal of MAP2 3

Purification: Affinity purified

Immunogène: MAP2 K3 antibody was raised using the C terminal of MAP2 3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP2K3 Blocking Peptide, (ABIN937766), is also available for use as a blocking control in assays to test for specificity of this MAP2K3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP2K3

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Autre désignation: MAP2K3

Sujet: MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2