ATP6V1C1 anticorps (N-Term)

N° du produit ABIN631307

Détail du produit anti-ATP6V1C1 anticorps

Antigène: ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V1C1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1

Purification: Affinity purified

Immunogène: ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V1C1 Blocking Peptide, catalog no. 33R-6113, is also available for use as a blocking control in assays to test for specificity of this ATP6V1C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V1C1

Antigène: ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))

Autre désignation: ATP6V1C1 (ATP6V1C1 Produits)

Synonymes: anticorps ATP6C, anticorps ATP6D, anticorps VATC, anticorps Vma5, anticorps 1700025B18Rik, anticorps U13839, anticorps vatC, anticorps ATPase, anticorps atp6v1c1, anticorps si:zc215i13.2, anticorps wu:fd12h05, anticorps atp6v1c1l, anticorps zgc:92684, anticorps ATPase H+ transporting V1 subunit C1, anticorps ATPase, H+ transporting, lysosomal V1 subunit C1, anticorps ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, anticorps ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 L homeolog, anticorps ATPase, H+ transporting, lysosomal, V1 subunit C1a, anticorps ATPase, H+ transporting, lysosomal, V1 subunit C1b, anticorps ATP6V1C1, anticorps Atp6v1c1, anticorps atp6v1c1, anticorps atp6v1c1.L, anticorps atp6v1c1a, anticorps atp6v1c1b

Sujet: ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport