CRABP2 anticorps (Middle Region)

N° du produit ABIN631322

L’anticorps anti-CRABP2 Polyclonal Lapin est utilisé pour la détection de CRABP2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CRABP2 anticorps (Middle Region) (ABIN631322)

Antigène: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRABP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CRABP2 anticorps

Épitope: Middle Region

Specificité: CRABP2 antibody was raised against the middle region of CRABP2

Purification: Affinity purified

Immunogène: CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRABP2 Blocking Peptide, (ABIN938263), is also available for use as a blocking control in assays to test for specificity of this CRABP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRABP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRABP2

Antigène: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Autre désignation: CRABP2

Sujet: A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 geneuggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.

Poids moléculaire: 16 kDa (MW of target protein)