CRABP2 anticorps (Middle Region)
-
- Antigène Voir toutes CRABP2 Anticorps
- CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRABP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRABP2 antibody was raised against the middle region of CRABP2
- Purification
- Affinity purified
- Immunogène
- CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI
- Top Product
- Discover our top product CRABP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRABP2 Blocking Peptide, catalog no. 33R-2877, is also available for use as a blocking control in assays to test for specificity of this CRABP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRABP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))
- Autre désignation
- CRABP2 (CRABP2 Produits)
- Synonymes
- anticorps crabp, anticorps crabp2-A, anticorps xCRABP, anticorps xCRABP-b, anticorps cb432, anticorps cb434, anticorps crabp2, anticorps sb:cb434, anticorps wu:fc51a11, anticorps zgc:110496, anticorps CRABP2, anticorps rbp6, anticorps MGC89469, anticorps crabp-ii, anticorps CRABP-II, anticorps RBP6, anticorps AI893628, anticorps Crabp-2, anticorps CrabpII, anticorps im:7136989, anticorps cellular retinoic acid binding protein 2 L homeolog, anticorps cellular retinoic acid binding protein 2, a, anticorps cellular retinoic acid binding protein 2, anticorps cellular retinoic acid binding protein II, anticorps cellular retinoic acid binding protein 2, b, anticorps crabp2.L, anticorps crabp2a, anticorps CRABP2, anticorps crabp2, anticorps Crabp2, anticorps crabp2b
- Sujet
- A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 geneuggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
- Poids moléculaire
- 16 kDa (MW of target protein)
-