TTC6 anticorps (C-Term)

N° du produit ABIN631330

Détail du produit anti-TTC6 anticorps

Antigène: TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC6 antibody was raised against the C terminal of TTC6

Purification: Affinity purified

Immunogène: TTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC6 Blocking Peptide, catalog no. 33R-6131, is also available for use as a blocking control in assays to test for specificity of this TTC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC6

Antigène: TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))

Autre désignation: TTC6 (TTC6 Produits)

Synonymes: anticorps C14orf25, anticorps NCRNA00291, anticorps 4921506M07Rik, anticorps EG639426, anticorps Gm69, anticorps Gm9813, anticorps tetratricopeptide repeat domain 6, anticorps TTC6, anticorps Ttc6

Sujet: TTC6 is involved in protein binding.

Poids moléculaire: 59 kDa (MW of target protein)