TTC6 anticorps (C-Term)
-
- Antigène Tous les produits TTC6
- TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TTC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TTC6 antibody was raised against the C terminal of TTC6
- Purification
- Affinity purified
- Immunogène
- TTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TTC6 Blocking Peptide, catalog no. 33R-6131, is also available for use as a blocking control in assays to test for specificity of this TTC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TTC6 (Tetratricopeptide Repeat Domain 6 (TTC6))
- Autre désignation
- TTC6 (TTC6 Produits)
- Synonymes
- anticorps C14orf25, anticorps NCRNA00291, anticorps 4921506M07Rik, anticorps EG639426, anticorps Gm69, anticorps Gm9813, anticorps tetratricopeptide repeat domain 6, anticorps TTC6, anticorps Ttc6
- Sujet
- TTC6 is involved in protein binding.
- Poids moléculaire
- 59 kDa (MW of target protein)
-