PCGF6 anticorps (Middle Region)

N° du produit ABIN631335

Détail du produit anti-PCGF6 anticorps

Antigène: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCGF6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCGF6 antibody was raised against the middle region of PCGF6

Purification: Affinity purified

Immunogène: PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCGF6 Blocking Peptide, catalog no. 33R-9248, is also available for use as a blocking control in assays to test for specificity of this PCGF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCGF6

Antigène: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Autre désignation: PCGF6 (PCGF6 Produits)

Synonymes: anticorps im:7144322, anticorps si:ch211-67n3.7, anticorps MBLR, anticorps RNF134, anticorps 4933407A11Rik, anticorps AI604840, anticorps Rnf134, anticorps polycomb group ring finger 6, anticorps PCGF6, anticorps pcgf6, anticorps Pcgf6

Sujet: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 30 kDa (MW of target protein)