CGR19 anticorps (Middle Region)

N° du produit ABIN631344

Détail du produit anti-CGR19 anticorps

Antigène: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CGR19 est non-conjugé

Application: Western Blotting (WB)

Specificité: CGRRF1 antibody was raised against the middle region of CGRRF1

Purification: Affinity purified

Immunogène: CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CGRRF1 Blocking Peptide, catalog no. 33R-4453, is also available for use as a blocking control in assays to test for specificity of this CGRRF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CGRRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CGR19

Antigène: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Autre désignation: CGRRF1 (CGRRF1 Produits)

Synonymes: anticorps MGC85426, anticorps CGRRF1, anticorps si:dkey-29m11.5, anticorps si:dkey-63j12.2, anticorps zgc:136229, anticorps CGR19, anticorps RNF197, anticorps 1110038G02Rik, anticorps 1810009H17Rik, anticorps Cgr19, anticorps cell growth regulator with ring finger domain 1 L homeolog, anticorps cell growth regulator with ring finger domain 1, anticorps cgrrf1.L, anticorps CGRRF1, anticorps cgrrf1, anticorps Cgrrf1

Sujet: CGRRF1 is able to inhibit growth in several cell lines.

Poids moléculaire: 38 kDa (MW of target protein)