UBE4A anticorps
-
- Antigène Voir toutes UBE4A Anticorps
- UBE4A (Ubiquitination Factor E4A (UBE4A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE4A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UBE4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR
- Top Product
- Discover our top product UBE4A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE4A Blocking Peptide, catalog no. 33R-7789, is also available for use as a blocking control in assays to test for specificity of this UBE4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE4A (Ubiquitination Factor E4A (UBE4A))
- Autre désignation
- UBE4A (UBE4A Produits)
- Synonymes
- anticorps 4732444G18Rik, anticorps 9930123J21Rik, anticorps UFD2b, anticorps ufd2, anticorps ubox2, anticorps E4, anticorps UBOX2, anticorps UFD2, anticorps Ab2-232, anticorps ubiquitination factor E4A S homeolog, anticorps ubiquitination factor E4A, anticorps ubiquitination factor E4A (UFD2 homolog, yeast), anticorps ubiquitin conjugation factor E4 A, anticorps putative ubiquitination factor E4a, anticorps ube4a.S, anticorps Ube4a, anticorps UBE4A, anticorps ube4a, anticorps LOC5563714, anticorps Smp_030780
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
- Poids moléculaire
- 123 kDa (MW of target protein)
-