TRIM55 anticorps (Middle Region)
-
- Antigène Voir toutes TRIM55 Anticorps
- TRIM55 (Tripartite Motif Containing 55 (TRIM55))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIM55 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRIM55 antibody was raised against the middle region of TRIM55
- Purification
- Affinity purified
- Immunogène
- TRIM55 antibody was raised using the middle region of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ
- Top Product
- Discover our top product TRIM55 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIM55 Blocking Peptide, catalog no. 33R-8465, is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIM55 (Tripartite Motif Containing 55 (TRIM55))
- Autre désignation
- TRIM55 (TRIM55 Produits)
- Synonymes
- anticorps MURF-2, anticorps RNF29, anticorps muRF2, anticorps trim55, anticorps wu:fb71c01, anticorps zgc:92123, anticorps TRIM55, anticorps im:7145460, anticorps zgc:136833, anticorps D830041C10Rik, anticorps Murf2, anticorps Rnf29, anticorps murf-2, anticorps rnf29, anticorps tripartite motif containing 55, anticorps tripartite motif containing 55a, anticorps tripartite motif containing 55b, anticorps tripartite motif-containing 55, anticorps tripartite motif containing 55 L homeolog, anticorps TRIM55, anticorps trim55a, anticorps trim55b, anticorps Trim55, anticorps trim55.L
- Sujet
- TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.
- Poids moléculaire
- 27 kDa (MW of target protein)
-