CHPF2 anticorps (N-Term)

N° du produit ABIN631398

Cet anticorps anti-CHPF2 Polyclonal Lapin (ABIN631398) détecte spécifiquement CHPF2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour CHPF2 anticorps (N-Term) (ABIN631398)

Antigène: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHPF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHPF2 anticorps

Épitope: N-Term

Specificité: CSGLCA-T antibody was raised against the N terminal Of Csglca-T

Purification: Affinity purified

Immunogène: CSGLCA-T antibody was raised using the N terminal Of Csglca-T corresponding to a region with amino acids SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSGLCA-T Blocking Peptide, (ABIN5613016), is also available for use as a blocking control in assays to test for specificity of this CSGLCA-T antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGLCA-T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHPF2

Antigène: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Autre désignation: CSGLCA-T

Sujet: CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process