CHPF2 anticorps (N-Term)
-
- Antigène Voir toutes CHPF2 Anticorps
- CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHPF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CSGLCA-T antibody was raised against the N terminal Of Csglca-T
- Purification
- Affinity purified
- Immunogène
- CSGLCA-T antibody was raised using the N terminal Of Csglca-T corresponding to a region with amino acids SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY
- Top Product
- Discover our top product CHPF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CSGLCA-T Blocking Peptide, catalog no. 33R-8608, is also available for use as a blocking control in assays to test for specificity of this CSGLCA-T antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGLCA-T antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))
- Autre désignation
- CSGLCA-T (CHPF2 Produits)
- Synonymes
- anticorps RGD1306404, anticorps AW060945, anticorps mKIAA1402, anticorps 2010209O12Rik, anticorps CSGLCA-T, anticorps CSGlcAT, anticorps ChSy-3, anticorps chondroitin polymerizing factor 2, anticorps Chpf2, anticorps CHPF2, anticorps chpf2
- Sujet
- CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity.
- Poids moléculaire
- 18 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-