GSTM2 anticorps

N° du produit ABIN631421

Détail du produit anti-GSTM2 anticorps

Antigène: GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTM2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTM2 Blocking Peptide, catalog no. 33R-9250, is also available for use as a blocking control in assays to test for specificity of this GSTM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTM2

Antigène: GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))

Autre désignation: GSTM2 (GSTM2 Produits)

Synonymes: anticorps GSTA4, anticorps GST4, anticorps GSTM, anticorps GSTM2-2, anticorps GTHMUS, anticorps Gstb-2, anticorps Gstb2, anticorps GSTIV, anticorps glutathione S-transferase mu 2, anticorps glutathione S-transferase mu 2 (muscle), anticorps glutathione S-transferase Mu 2, anticorps glutathione S-transferase, mu 2, anticorps glutathione S-transferase 2, anticorps Glutathione S-transferase 4, anticorps Gstm2, anticorps GSTM2, anticorps LOC100732167, anticorps gst2, anticorps gst-4

Sujet: GSTM2 is a glutathione S-transferase that belongs to the mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity