PEX26 anticorps (Middle Region)
-
- Antigène Voir toutes PEX26 Anticorps
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEX26 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PEX26 antibody was raised against the middle region of PEX26
- Purification
- Affinity purified
- Immunogène
- PEX26 antibody was raised using the middle region of PEX26 corresponding to a region with amino acids ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK
- Top Product
- Discover our top product PEX26 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEX26 Blocking Peptide, catalog no. 33R-2580, is also available for use as a blocking control in assays to test for specificity of this PEX26 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX26 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
- Autre désignation
- PEX26 (PEX26 Produits)
- Synonymes
- anticorps fk41g06, anticorps zgc:64014, anticorps wu:fk41g06, anticorps PBD7A, anticorps PBD7B, anticorps PEX26M1T, anticorps Pex26pM1T, anticorps 4632428M11Rik, anticorps AI853212, anticorps peroxisomal biogenesis factor 26, anticorps peroxisomal biogenesis factor 26 L homeolog, anticorps pex26, anticorps PEX26, anticorps pex26.L, anticorps Pex26
- Sujet
- This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes.
- Poids moléculaire
- 34 kDa (MW of target protein)
-