PDS5B anticorps

N° du produit ABIN631437

Détail du produit anti-PDS5B anticorps

Antigène: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDS5B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PDS5 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDS5B Blocking Peptide, catalog no. 33R-1917, is also available for use as a blocking control in assays to test for specificity of this PDS5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDS5B

Antigène: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Autre désignation: PDS5B (PDS5B Produits)

Synonymes: anticorps APRIN, anticorps AS3, anticorps CG008, anticorps Aprin, anticorps as3, anticorps aprin, anticorps AI646570, anticorps AW212954, anticorps mKIAA0979, anticorps pds5b, anticorps PDS5 cohesin associated factor B, anticorps PDS5 cohesin associated factor B L homeolog, anticorps PDS5B, anticorps Pds5b, anticorps pds5b, anticorps pds5b.L

Sujet: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Poids moléculaire: 159 kDa (MW of target protein)