CDCA5 anticorps (Middle Region)

N° du produit ABIN631455

Cet anticorps anti-CDCA5 Polyclonal Lapin (ABIN631455) détecte spécifiquement CDCA5 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour CDCA5 anticorps (Middle Region) (ABIN631455)

Antigène: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDCA5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDCA5 anticorps

Épitope: Middle Region

Specificité: CDCA5 antibody was raised against the middle region of CDCA5

Purification: Affinity purified

Immunogène: CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDCA5 Blocking Peptide, (ABIN5612778), is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDCA5

Antigène: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Autre désignation: CDCA5

Sujet: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Chromatin Binding