CDCA5 anticorps (Middle Region)

N° du produit ABIN631455

Détail du produit anti-CDCA5 anticorps

Antigène: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDCA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDCA5 antibody was raised against the middle region of CDCA5

Purification: Affinity purified

Immunogène: CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDCA5 Blocking Peptide, catalog no. 33R-8165, is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDCA5

Antigène: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Autre désignation: CDCA5 (CDCA5 Produits)

Synonymes: anticorps SORORIN, anticorps 2610036L13Rik, anticorps AL024086, anticorps AW536684, anticorps C85404, anticorps CDCA5, anticorps RGD1560863, anticorps sororin, anticorps cdca5, anticorps cell division cycle associated 5, anticorps cell division cycle associated 5 S homeolog, anticorps CDCA5, anticorps Cdca5, anticorps cdca5, anticorps cdca5.S

Sujet: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Chromatin Binding