SCGN anticorps (Middle Region)

N° du produit ABIN631459

Détail du produit anti-SCGN anticorps

Antigène: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCGN est non-conjugé

Application: Western Blotting (WB)

Specificité: SCGN antibody was raised against the middle region of SCGN

Purification: Affinity purified

Immunogène: SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCGN Blocking Peptide, catalog no. 33R-5304, is also available for use as a blocking control in assays to test for specificity of this SCGN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCGN

Antigène: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Autre désignation: SCGN (SCGN Produits)

Synonymes: anticorps SCGN, anticorps MGC146683, anticorps CALBL, anticorps DJ501N12.8, anticorps SECRET, anticorps SEGN, anticorps setagin, anticorps zgc:100843, anticorps secretagogin, EF-hand calcium binding protein, anticorps Secretagogin, anticorps secretagogin, EF-hand calcium binding protein L homeolog, anticorps SCGN, anticorps scgn, anticorps segn, anticorps scgn.L, anticorps Scgn

Sujet: SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Poids moléculaire: 32 kDa (MW of target protein)