SCGN anticorps (Middle Region)
-
- Antigène Voir toutes SCGN Anticorps
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SCGN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SCGN antibody was raised against the middle region of SCGN
- Purification
- Affinity purified
- Immunogène
- SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM
- Top Product
- Discover our top product SCGN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SCGN Blocking Peptide, catalog no. 33R-5304, is also available for use as a blocking control in assays to test for specificity of this SCGN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
- Autre désignation
- SCGN (SCGN Produits)
- Synonymes
- anticorps SCGN, anticorps MGC146683, anticorps CALBL, anticorps DJ501N12.8, anticorps SECRET, anticorps SEGN, anticorps setagin, anticorps zgc:100843, anticorps secretagogin, EF-hand calcium binding protein, anticorps Secretagogin, anticorps secretagogin, EF-hand calcium binding protein L homeolog, anticorps SCGN, anticorps scgn, anticorps segn, anticorps scgn.L, anticorps Scgn
- Sujet
- SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.
- Poids moléculaire
- 32 kDa (MW of target protein)
-