TKTL2 anticorps (N-Term)

N° du produit ABIN631467

Détail du produit anti-TKTL2 anticorps

Antigène: TKTL2 (Transketolase-Like 2 (TKTL2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TKTL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TKTL2 antibody was raised against the N terminal of TKTL2

Purification: Affinity purified

Immunogène: TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TKTL2 Blocking Peptide, catalog no. 33R-7651, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TKTL2

Antigène: TKTL2 (Transketolase-Like 2 (TKTL2))

Autre désignation: TKTL2 (TKTL2 Produits)

Synonymes: anticorps TKTL2, anticorps 4933401I19Rik, anticorps RGD1304767, anticorps transketolase like 2, anticorps transketolase-like 2 L homeolog, anticorps transketolase-like 2, anticorps TKTL2, anticorps tktl2.L, anticorps Tktl2

Sujet: The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 68 kDa (MW of target protein)