TKTL2 anticorps (N-Term)
-
- Antigène Voir toutes TKTL2 Anticorps
- TKTL2 (Transketolase-Like 2 (TKTL2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TKTL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TKTL2 antibody was raised against the N terminal of TKTL2
- Purification
- Affinity purified
- Immunogène
- TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW
- Top Product
- Discover our top product TKTL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TKTL2 Blocking Peptide, catalog no. 33R-7651, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TKTL2 (Transketolase-Like 2 (TKTL2))
- Autre désignation
- TKTL2 (TKTL2 Produits)
- Synonymes
- anticorps TKTL2, anticorps 4933401I19Rik, anticorps RGD1304767, anticorps transketolase like 2, anticorps transketolase-like 2 L homeolog, anticorps transketolase-like 2, anticorps TKTL2, anticorps tktl2.L, anticorps Tktl2
- Sujet
- The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 68 kDa (MW of target protein)
-