LASP1 anticorps (Middle Region)

N° du produit ABIN631471

Cet anticorps Lapin Polyclonal détecte spécifiquement LASP1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LASP1 anticorps (Middle Region) (ABIN631471)

Antigène: LASP1 (LIM and SH3 Protein 1 (LASP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LASP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LASP1 anticorps

Épitope: Middle Region

Specificité: LASP1 antibody was raised against the middle region of LASP1

Purification: Affinity purified

Immunogène: LASP1 antibody was raised using the middle region of LASP1 corresponding to a region with amino acids IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LASP1 Blocking Peptide, (ABIN939409), is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LASP1

Antigène: LASP1 (LIM and SH3 Protein 1 (LASP1))

Autre désignation: LASP1

Sujet: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

Poids moléculaire: 30 kDa (MW of target protein)