LASP1 anticorps (Middle Region)
-
- Antigène Voir toutes LASP1 Anticorps
- LASP1 (LIM and SH3 Protein 1 (LASP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LASP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LASP1 antibody was raised against the middle region of LASP1
- Purification
- Affinity purified
- Immunogène
- LASP1 antibody was raised using the middle region of LASP1 corresponding to a region with amino acids IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ
- Top Product
- Discover our top product LASP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LASP1 Blocking Peptide, catalog no. 33R-4023, is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LASP1 (LIM and SH3 Protein 1 (LASP1))
- Autre désignation
- LASP1 (LASP1 Produits)
- Synonymes
- anticorps lasp1, anticorps MGC53336, anticorps LASP1, anticorps MGC89667, anticorps Lasp-1, anticorps MLN50, anticorps AA408629, anticorps Def-4, anticorps SH3P6, anticorps Tg(Col1a1-lacZ)1Ngma, anticorps fb92f05, anticorps wu:fb92f05, anticorps zgc:77542, anticorps lasp-1, anticorps mln50, anticorps LIM and SH3 protein 1, anticorps LIM and SH3 protein 1 L homeolog, anticorps lasp1, anticorps lasp1.L, anticorps LASP1, anticorps Lasp1
- Sujet
- LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.
- Poids moléculaire
- 30 kDa (MW of target protein)
-