GPT2 anticorps

N° du produit ABIN631541

Détail du produit anti-GPT2 anticorps

Antigène: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPT2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPT2 Blocking Peptide, catalog no. 33R-2475, is also available for use as a blocking control in assays to test for specificity of this GPT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPT2

Antigène: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Autre désignation: GPT2 (GPT2 Produits)

Synonymes: anticorps ALT2, anticorps GPT2, anticorps im:7150662, anticorps sb:cb580, anticorps zgc:165657, anticorps Cc2-5, anticorps 4631422C05Rik, anticorps AU014768, anticorps AU041193, anticorps C87201, anticorps ALANINE AMINOTRANSFERASE 2, anticorps AtAlaAT2, anticorps AtAlaATm, anticorps T10D10.20, anticorps T10D10_20, anticorps alanine aminotransferase 2, anticorps glutamic--pyruvic transaminase 2, anticorps glutamic pyruvate transaminase (alanine aminotransferase) 2 L homeolog, anticorps glutamic pyruvate transaminase (alanine aminotransferase) 2, anticorps alanine aminotransferase 2, anticorps GPT2, anticorps gpt2.L, anticorps gpt2, anticorps PTRG_06494, anticorps Gpt2, anticorps ALAAT2

Sujet: GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.

Poids moléculaire: 58 kDa (MW of target protein)