GABARAPL1 anticorps

N° du produit ABIN631573

Détail du produit anti-GABARAPL1 anticorps

Antigène: GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABARAPL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABARAPL1 Blocking Peptide, catalog no. 33R-6137, is also available for use as a blocking control in assays to test for specificity of this GABARAPL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABARAPL1

Antigène: GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))

Autre désignation: GABARAPL1 (GABARAPL1 Produits)

Synonymes: anticorps gabarapl1, anticorps apg8l, anticorps atg8, anticorps atg8l, anticorps gec1, anticorps gabarapl1-a, anticorps GABARAPL3, anticorps APG8-LIKE, anticorps APG8L, anticorps ATG8, anticorps ATG8B, anticorps ATG8L, anticorps GEC1, anticorps Gec1, anticorps 3110025G09Rik, anticorps 9130422N19Rik, anticorps AI196471, anticorps Apg8l, anticorps Atg8l, anticorps GECI, anticorps GEC-1, anticorps GABA(A) receptor-associated protein like 1, anticorps GABA(A) receptor-associated protein like 1 S homeolog, anticorps GABA type A receptor associated protein like 1, anticorps gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1, anticorps gabarapl1, anticorps gabarapl1.S, anticorps GABARAPL1, anticorps Gabarapl1

Sujet: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Autophagy