Nucleostemin anticorps

N° du produit ABIN631618

Détail du produit anti-Nucleostemin anticorps

Antigène: Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nucleostemin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNL3 Blocking Peptide, catalog no. 33R-6534, is also available for use as a blocking control in assays to test for specificity of this GNL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nucleostemin

Antigène: Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))

Autre désignation: GNL3 (GNL3 Produits)

Synonymes: anticorps id:ibd2914, anticorps nstm, anticorps wu:fb38a04, anticorps wu:fc55d07, anticorps zgc:123093, anticorps e2ig3, anticorps C77032, anticorps E2IG3, anticorps NNP47, anticorps NS, anticorps BC037996, anticorps Ns, anticorps guanine nucleotide binding protein-like 3 (nucleolar), anticorps G protein nucleolar 3, anticorps guanine nucleotide binding protein-like 3 (nucleolar) L homeolog, anticorps gnl3, anticorps GNL3, anticorps Gnl3, anticorps gnl3.L

Sujet: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.

Poids moléculaire: 60 kDa (MW of target protein)