SMARCD1 anticorps (Middle Region)
-
- Antigène Voir toutes SMARCD1 Anticorps
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMARCD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SMARCD1 antibody was raised against the middle region of Smarcd1
- Purification
- Affinity purified
- Immunogène
- SMARCD1 antibody was raised using the middle region of Smarcd1 corresponding to a region with amino acids RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
- Top Product
- Discover our top product SMARCD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMARCD1 Blocking Peptide, catalog no. 33R-8003, is also available for use as a blocking control in assays to test for specificity of this SMARCD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMARCD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
- Autre désignation
- SMARCD1 (SMARCD1 Produits)
- Synonymes
- anticorps rsc6p, anticorps baf60a, anticorps cracd1, anticorps MGC69403, anticorps BAF60A, anticorps CRACD1, anticorps Rsc6p, anticorps wu:fa10h07, anticorps wu:fb82d01, anticorps wu:fi45f10, anticorps AA407987, anticorps Baf60a, anticorps D15Kz1, anticorps SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1, anticorps SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 L homeolog, anticorps SMARCD1, anticorps smarcd1, anticorps smarcd1.L, anticorps Smarcd1
- Sujet
- SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.
- Poids moléculaire
- 58 kDa (MW of target protein)
-