RBBP7 anticorps (Middle Region)
-
- Antigène Voir toutes RBBP7 Anticorps
- RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBBP7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBBP7 antibody was raised against the middle region of RBBP7
- Purification
- Affinity purified
- Immunogène
- RBBP7 antibody was raised using the middle region of RBBP7 corresponding to a region with amino acids HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH
- Top Product
- Discover our top product RBBP7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBBP7 Blocking Peptide, catalog no. 33R-3875, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))
- Autre désignation
- RBBP7 (RBBP7 Produits)
- Synonymes
- anticorps RbAp46, anticorps AA409861, anticorps AI173248, anticorps AU019541, anticorps BB114024, anticorps mRbAp46, anticorps rbap46, anticorps RBBP7, anticorps RBBP-7, anticorps Caf1, anticorps rbbp7, anticorps wu:fa13g08, anticorps wu:fb50h10, anticorps wu:fc29d09, anticorps zgc:56477, anticorps zgc:85617, anticorps CaO19.2146, anticorps RB binding protein 7, chromatin remodeling factor, anticorps retinoblastoma binding protein 7, chromatin remodeling factor, anticorps retinoblastoma binding protein 7 L homeolog, anticorps retinoblastoma binding protein 7, anticorps retinoblastoma binding protein 4, like, anticorps histone-binding protein RBBP7, anticorps Hat2p, anticorps RBBP7, anticorps Rbbp7, anticorps rbbp7.L, anticorps rbbp7, anticorps rbb4l, anticorps LOC108708306, anticorps HAT2
- Sujet
- This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.
- Poids moléculaire
- 48 kDa (MW of target protein)
-