GNB1 anticorps

N° du produit ABIN631690

Cet anticorps Lapin Polyclonal détecte spécifiquement GNB1 dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour GNB1 anticorps (ABIN631690)

Antigène: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GNB1 anticorps

Purification: Affinity purified

Immunogène: GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNB1 Blocking Peptide, (ABIN5613810), is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNB1

Antigène: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Autre désignation: GNB1

Sujet: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interactome