GNB1 anticorps

N° du produit ABIN631690

Détail du produit anti-GNB1 anticorps

Antigène: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNB1 Blocking Peptide, catalog no. 33R-6416, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNB1

Antigène: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Autre désignation: GNB1 (GNB1 Produits)

Synonymes: anticorps gnb1, anticorps wu:fb50b09, anticorps wu:fj94h04, anticorps AA409223, anticorps C77571, anticorps Gnb-1, anticorps XGB1, anticorps xgbeta1, anticorps GNB1x, anticorps fb39f01, anticorps gnb1l, anticorps wu:fb39f01, anticorps wu:fb98e06, anticorps wu:fj09d12, anticorps zgc:55774, anticorps G protein subunit beta 1, anticorps guanine nucleotide binding protein (G protein), beta polypeptide 1a, anticorps guanine nucleotide binding protein (G protein), beta 1, anticorps guanine nucleotide binding protein (G protein), beta polypeptide 1 S homeolog, anticorps guanine nucleotide binding protein (G protein), beta polypeptide 1b, anticorps GNB1, anticorps gnb1a, anticorps Gnb1, anticorps gnb1.S, anticorps gnb1b

Sujet: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interactome