PITPNB anticorps (Middle Region)
-
- Antigène Voir toutes PITPNB Anticorps
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PITPNB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PITPNB antibody was raised against the middle region of PITPNB
- Purification
- Affinity purified
- Immunogène
- PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY
- Top Product
- Discover our top product PITPNB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PITPNB Blocking Peptide, catalog no. 33R-1104, is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
- Autre désignation
- PITPNB (PITPNB Produits)
- Synonymes
- anticorps VIB1B, anticorps MGC75853, anticorps PtdInsTP, anticorps PI-TP-beta, anticorps pitpn, anticorps AI256223, anticorps AU040890, anticorps zgc:56092, anticorps phosphatidylinositol transfer protein, beta, anticorps phosphatidylinositol transfer protein, beta L homeolog, anticorps phosphatidylinositol transfer protein beta, anticorps pitpnb, anticorps pitpnb.L, anticorps PITPNB, anticorps Pitpnb
- Sujet
- PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
- Poids moléculaire
- 31 kDa (MW of target protein)
-