NME4 anticorps (Middle Region)
-
- Antigène Voir toutes NME4 Anticorps
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NME4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NME4 antibody was raised against the middle region of NME4
- Purification
- Affinity purified
- Immunogène
- NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV
- Top Product
- Discover our top product NME4 Anticorps primaire
-
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 1-30), (N-Term) antibody
NME4 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB4055-4056 unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 1-187) antibodyNME4 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 158-187), (C-Term) antibodyNME4 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB4058 unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) antibodyNME4 Reactivité: Humain, Souris IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 99-187) antibodyNME4 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 4B6 unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (C-Term) antibodyNME4 Reactivité: Humain WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) antibodyNME4 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 1-187) antibodyNME4 Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 1-187) antibodyNME4 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (AA 107-156) antibodyNME4 Reactivité: Humain, Boeuf (Vache), Lapin, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NME4 Blocking Peptide, catalog no. 33R-9429, is also available for use as a blocking control in assays to test for specificity of this NME4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NME4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
- Autre désignation
- NME4 (NME4 Produits)
- Synonymes
- anticorps NDPK-D, anticorps NM23H4, anticorps nm23-H4, anticorps 2610027N22Rik, anticorps 2810024O08Rik, anticorps 5730493H09Rik, anticorps NM23-M4, anticorps Nm23M4, anticorps NME/NM23 nucleoside diphosphate kinase 4, anticorps NME4, anticorps Nme4
- Sujet
- The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-
