TNP1 anticorps
-
- Antigène Voir toutes TNP1 Anticorps
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TNP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
- Top Product
- Discover our top product TNP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TNP1 Blocking Peptide, catalog no. 33R-6520, is also available for use as a blocking control in assays to test for specificity of this TNP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
- Autre désignation
- TNP1 (TNP1 Produits)
- Synonymes
- anticorps TNP1, anticorps TP1, anticorps Stp-1, anticorps Tp-1, anticorps STP-1, anticorps TP-1, anticorps transition protein 1, anticorps TNP1, anticorps Tnp1
- Sujet
- TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.
- Poids moléculaire
- 6 kDa (MW of target protein)
-