GCOM1 anticorps (Middle Region)
-
- Antigène Voir toutes GCOM1 Anticorps
- GCOM1 (GRINL1A Complex Locus (GCOM1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GCOM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GCOM1 antibody was raised against the middle region of Gcom1
- Purification
- Affinity purified
- Immunogène
- GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
- Top Product
- Discover our top product GCOM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GCOM1 Blocking Peptide, catalog no. 33R-9433, is also available for use as a blocking control in assays to test for specificity of this GCOM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCOM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GCOM1 (GRINL1A Complex Locus (GCOM1))
- Autre désignation
- GCOM1 (GCOM1 Produits)
- Sujet
- This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.
- Poids moléculaire
- 52 kDa (MW of target protein)
-