GCOM1 anticorps (Middle Region)

N° du produit ABIN631848

Détail du produit anti-GCOM1 anticorps

Antigène: GCOM1 (GRINL1A Complex Locus (GCOM1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCOM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GCOM1 antibody was raised against the middle region of Gcom1

Purification: Affinity purified

Immunogène: GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCOM1 Blocking Peptide, catalog no. 33R-9433, is also available for use as a blocking control in assays to test for specificity of this GCOM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCOM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCOM1

Antigène: GCOM1 (GRINL1A Complex Locus (GCOM1))

Autre désignation: GCOM1 (GCOM1 Produits)

Sujet: This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.

Poids moléculaire: 52 kDa (MW of target protein)