NUDCD3 anticorps (Middle Region)

N° du produit ABIN631858

Détail du produit anti-NUDCD3 anticorps

Antigène: NUDCD3 (NudC Domain Containing 3 (NUDCD3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUDCD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUDCD3 antibody was raised against the middle region of NUDCD3

Purification: Affinity purified

Immunogène: NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUDCD3 Blocking Peptide, catalog no. 33R-4441, is also available for use as a blocking control in assays to test for specificity of this NUDCD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUDCD3

Antigène: NUDCD3 (NudC Domain Containing 3 (NUDCD3))

Autre désignation: NUDCD3 (NUDCD3 Produits)

Synonymes: anticorps NudCL, anticorps AI427847, anticorps BC024322, anticorps RP23-28G13.2, anticorps mKIAA1068, anticorps NudC domain containing 3, anticorps Nudcd3, anticorps NUDCD3

Sujet: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain and mislocalization of the dynein complex from kinetochores.

Poids moléculaire: 41 kDa (MW of target protein)