PUS10 anticorps (Middle Region)

N° du produit ABIN631863

Détail du produit anti-PUS10 anticorps

Antigène: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PUS10 est non-conjugé

Application: Western Blotting (WB)

Specificité: PUS10 antibody was raised against the middle region of PUS10

Purification: Affinity purified

Immunogène: PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PUS10

Antigène: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Autre désignation: PUS10 (PUS10 Produits)

Synonymes: anticorps CCDC139, anticorps DOBI, anticorps 2810013G11Rik, anticorps 4933435A13Rik, anticorps AU014648, anticorps C77560, anticorps Ccdc139, anticorps RGD1306402, anticorps pseudouridylate synthase 10, anticorps PUS10, anticorps Pus10

Sujet: Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.

Poids moléculaire: 60 kDa (MW of target protein)