MMD2 anticorps (N-Term)

N° du produit ABIN631886

Détail du produit anti-MMD2 anticorps

Antigène: MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MMD2 antibody was raised against the N terminal of MMD2

Purification: Affinity purified

Immunogène: MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMD2 Blocking Peptide, catalog no. 33R-2846, is also available for use as a blocking control in assays to test for specificity of this MMD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMD2

Antigène: MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))

Autre désignation: MMD2 (MMD2 Produits)

Synonymes: anticorps PAQR10, anticorps 4930518M15Rik, anticorps C88001, anticorps mmd2, anticorps paqr10, anticorps si:dkey-21n8.8, anticorps monocyte to macrophage differentiation associated 2, anticorps monocyte to macrophage differentiation-associated 2, anticorps monocyte to macrophage differentiation-associated 2a, anticorps MMD2, anticorps Mmd2, anticorps mmd2a

Sujet: MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Poids moléculaire: 31 kDa (MW of target protein)