EARS2 anticorps

N° du produit ABIN631902

Détail du produit anti-EARS2 anticorps

Antigène: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EARS2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EARS2

Antigène: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Autre désignation: EARS2 (EARS2 Produits)

Synonymes: anticorps mse1, anticorps 3230401I01Rik, anticorps AL024049, anticorps mKIAA1970, anticorps COXPD12, anticorps MSE1, anticorps RGD1307904, anticorps ears2, anticorps glutamyl-tRNA synthetase 2, mitochondrial, anticorps zgc:153247, anticorps EARS2, anticorps ears2, anticorps Ears2, anticorps zgc:153247

Sujet: EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

Poids moléculaire: 59 kDa (MW of target protein)