GCLM anticorps (Middle Region)

N° du produit ABIN631928

Détail du produit anti-GCLM anticorps

Antigène: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCLM est non-conjugé

Application: Western Blotting (WB)

Specificité: GCLM antibody was raised against the middle region of GCLM

Purification: Affinity purified

Immunogène: GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCLM Blocking Peptide, catalog no. 33R-4592, is also available for use as a blocking control in assays to test for specificity of this GCLM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCLM

Antigène: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Autre désignation: GCLM (GCLM Produits)

Synonymes: anticorps Glclr, anticorps GLCLR, anticorps id:ibd3182, anticorps wu:fi24c07, anticorps zgc:55903, anticorps AI649393, anticorps Gcmc, anticorps glutamate-cysteine ligase regulatory subunit, anticorps glutamate cysteine ligase, modifier subunit, anticorps glutamate-cysteine ligase modifier subunit, anticorps glutamate-cysteine ligase, modifier subunit, anticorps glutamate-cysteine ligase, modifier subunit L homeolog, anticorps PTRG_09814, anticorps Gclm, anticorps GCLM, anticorps gclm, anticorps gclm.L

Sujet: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.

Poids moléculaire: 31 kDa (MW of target protein)