FUNDC1 anticorps (Middle Region)

N° du produit ABIN631937

Détail du produit anti-FUNDC1 anticorps

Antigène: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FUNDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FUNDC1 antibody was raised against the middle region of FUNDC1

Purification: Affinity purified

Immunogène: FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FUNDC1 Blocking Peptide, catalog no. 33R-8988, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FUNDC1

Antigène: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Autre désignation: FUNDC1 (FUNDC1 Produits)

Synonymes: anticorps fundc1-a, anticorps 1500005J14Rik, anticorps 1810033P05Rik, anticorps zgc:92600, anticorps FUN14 domain-containing protein 1-like, anticorps FUN14 domain containing 1 S homeolog, anticorps FUN14 domain containing 1, anticorps LOC100357289, anticorps fundc1.S, anticorps FUNDC1, anticorps Fundc1, anticorps fundc1

Sujet: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Poids moléculaire: 17 kDa (MW of target protein)