PRAMEF10 anticorps (Middle Region)

N° du produit ABIN631939

Détail du produit anti-PRAMEF10 anticorps

Antigène: PRAMEF10 (PRAME Family Member 10 (PRAMEF10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRAMEF10 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRAMEF10 antibody was raised against the middle region of PRAMEF10

Purification: Affinity purified

Immunogène: PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRAMEF10 Blocking Peptide, catalog no. 33R-2057, is also available for use as a blocking control in assays to test for specificity of this PRAMEF10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAMEF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRAMEF10

Antigène: PRAMEF10 (PRAME Family Member 10 (PRAMEF10))

Autre désignation: PRAMEF10 (PRAMEF10 Produits)

Synonymes: anticorps RP5-845O24.7, anticorps PRAME family member 10, anticorps PRAMEF10

Sujet: PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Poids moléculaire: 55 kDa (MW of target protein)