GABARAPL2 anticorps
-
- Antigène Voir toutes GABARAPL2 Anticorps
- GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GABARAPL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV
- Top Product
- Discover our top product GABARAPL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GABARAPL2 Blocking Peptide, catalog no. 33R-4731, is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))
- Autre désignation
- GABARAPL2 (GABARAPL2 Produits)
- Synonymes
- anticorps GABARAPL2, anticorps atg8, anticorps gef2, anticorps gate16, anticorps gate-16, anticorps Gef2, anticorps ATG8, anticorps ATG8C, anticorps GATE-16, anticorps GATE16, anticorps GEF-2, anticorps GEF2, anticorps zgc:92319, anticorps 0610012F20Rik, anticorps 2900019O08Rik, anticorps AI173605, anticorps GABA type A receptor associated protein like 2, anticorps GABA(A) receptor-associated protein like 2, anticorps GABA(A) receptor-associated protein like 2 L homeolog, anticorps gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2, anticorps GABARAPL2, anticorps gabarapl2, anticorps Gabarapl2, anticorps gabarapl2.L
- Sujet
- GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
- Poids moléculaire
- 14 kDa (MW of target protein)
- Pathways
- Autophagy
-