GABARAPL2 anticorps

N° du produit ABIN631966

Cet anticorps Lapin Polyclonal détecte spécifiquement GABARAPL2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour GABARAPL2 anticorps (ABIN631966)

Antigène: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABARAPL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GABARAPL2 anticorps

Purification: Affinity purified

Immunogène: GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABARAPL2 Blocking Peptide, (ABIN940117), is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABARAPL2

Antigène: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Autre désignation: GABARAPL2

Sujet: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Autophagy