GABARAPL2 anticorps

N° du produit ABIN631966

Détail du produit anti-GABARAPL2 anticorps

Antigène: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABARAPL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABARAPL2 Blocking Peptide, catalog no. 33R-4731, is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABARAPL2

Antigène: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Autre désignation: GABARAPL2 (GABARAPL2 Produits)

Synonymes: anticorps GABARAPL2, anticorps atg8, anticorps gef2, anticorps gate16, anticorps gate-16, anticorps Gef2, anticorps ATG8, anticorps ATG8C, anticorps GATE-16, anticorps GATE16, anticorps GEF-2, anticorps GEF2, anticorps zgc:92319, anticorps 0610012F20Rik, anticorps 2900019O08Rik, anticorps AI173605, anticorps GABA type A receptor associated protein like 2, anticorps GABA(A) receptor-associated protein like 2, anticorps GABA(A) receptor-associated protein like 2 L homeolog, anticorps gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2, anticorps GABARAPL2, anticorps gabarapl2, anticorps Gabarapl2, anticorps gabarapl2.L

Sujet: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Autophagy