TPGS2 anticorps (Middle Region)

N° du produit ABIN631976

Détail du produit anti-TPGS2 anticorps

Antigène: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPGS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: C18 ORF10 antibody was raised against the middle region of C18 rf10

Purification: Affinity purified

Immunogène: C18 ORF10 antibody was raised using the middle region of C18 rf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C18ORF10 Blocking Peptide, catalog no. 33R-8647, is also available for use as a blocking control in assays to test for specificity of this C18ORF10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPGS2

Antigène: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Autre désignation: C18ORF10 (C18orf10 Produits)

Synonymes: anticorps C18orf10, anticorps L17, anticorps PGs2, anticorps CZH18orf10, anticorps c18orf10, anticorps DKFZp468A177, anticorps 5730437P09Rik, anticorps 5730494M16Rik, anticorps AI666318, anticorps Pgs2, anticorps RGD1310571, anticorps C24H18orf10, anticorps zgc:91821, anticorps tubulin polyglutamylase complex subunit 2, anticorps tubulin polyglutamylase complex subunit 2 L homeolog, anticorps TPGS2, anticorps tpgs2.L, anticorps tpgs2, anticorps C18orf10, anticorps Tpgs2

Sujet: The function of C18orf10 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 33 kDa (MW of target protein)