CYP27C1 anticorps (Middle Region)
-
- Antigène Voir toutes CYP27C1 Anticorps
- CYP27C1 (Cytochrome P450, Family 27, Subfamily C, Polypeptide 1 (CYP27C1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP27C1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP27 C1 antibody was raised against the middle region of CYP27 1
- Purification
- Affinity purified
- Immunogène
- CYP27 C1 antibody was raised using the middle region of CYP27 1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
- Top Product
- Discover our top product CYP27C1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP27C1 Blocking Peptide, catalog no. 33R-9856, is also available for use as a blocking control in assays to test for specificity of this CYP27C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP27C1 (Cytochrome P450, Family 27, Subfamily C, Polypeptide 1 (CYP27C1))
- Autre désignation
- CYP27C1 (CYP27C1 Produits)
- Synonymes
- anticorps zgc:172278, anticorps cytochrome P450 family 27 subfamily C member 1, anticorps cytochrome P450, family 27, subfamily C, polypeptide 1, anticorps CYP27C1, anticorps cyp27c1
- Sujet
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Poids moléculaire
- 43 kDa (MW of target protein)
-