ARL8B anticorps (Middle Region)

N° du produit ABIN632059

Détail du produit anti-ARL8B anticorps

Antigène: ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL8B est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL8 B antibody was raised against the middle region of ARL8

Purification: Affinity purified

Immunogène: ARL8 B antibody was raised using the middle region of ARL8 corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL8B Blocking Peptide, catalog no. 33R-1997, is also available for use as a blocking control in assays to test for specificity of this ARL8B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL8B

Antigène: ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))

Autre désignation: ARL8B (ARL8B Produits)

Synonymes: anticorps ARL10C, anticorps Gie1, anticorps 2610313E07Rik, anticorps 3100002J04Rik, anticorps Arl10c, anticorps gie1, anticorps ADP ribosylation factor like GTPase 8B, anticorps ADP-ribosylation factor-like 8B, anticorps ADP-ribosylation factor like GTPase 8B, anticorps ARL8B, anticorps Arl8b

Sujet: ARL8B may play a role in lysosome motility and chromosome segregation.

Poids moléculaire: 21 kDa (MW of target protein)