PI4K2B anticorps (Middle Region)
-
- Antigène Voir toutes PI4K2B Anticorps
- PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PI4K2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PI4 K4 antibody was raised against the middle region of PI4 4
- Purification
- Affinity purified
- Immunogène
- PI4 K4 antibody was raised using the middle region of PI4 4 corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA
- Top Product
- Discover our top product PI4K2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PI4K2B Blocking Peptide, catalog no. 33R-3999, is also available for use as a blocking control in assays to test for specificity of this PI4K2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))
- Autre désignation
- PI4K2B (PI4K2B Produits)
- Synonymes
- anticorps GB16449, anticorps pi4kiib, anticorps pik42b, anticorps PI4KIIB, anticorps PIK42B, anticorps 2610042N09Rik, anticorps 4933409G22Rik, anticorps zgc:158305, anticorps uncharacterized LOC725812, anticorps phosphatidylinositol 4-kinase type 2 beta L homeolog, anticorps phosphatidylinositol 4-kinase type 2 beta, anticorps LOC725812, anticorps pi4k2b.L, anticorps PI4K2B, anticorps pi4k2b, anticorps Pi4k2b
- Sujet
- Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-