C16orf61 anticorps (Middle Region)

N° du produit ABIN632088

Détail du produit anti-C16orf61 anticorps

Antigène: C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C16orf61 est non-conjugé

Application: Western Blotting (WB)

Specificité: C16 ORF61 antibody was raised against the middle region of C16 rf61

Purification: Affinity purified

Immunogène: C16 ORF61 antibody was raised using the middle region of C16 rf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF61 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C16orf61

Antigène: C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))

Autre désignation: C16ORF61 (C16orf61 Produits)

Synonymes: anticorps 1110046L09Rik, anticorps 2310061C15Rik, anticorps DC13, anticorps C16orf61, anticorps C18H16orf61, anticorps si:busm1-241h12.4, anticorps si:dz241h12.4, anticorps zgc:92271, anticorps C-x(9)-C motif containing 2, anticorps C-x(9)-C motif containing 2 S homeolog, anticorps COX assembly mitochondrial protein 2, anticorps C-X9-C motif containing 2, anticorps cmc2, anticorps cmc2.S, anticorps CMC2, anticorps Cmc2

Sujet: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 9 kDa (MW of target protein)