ASPHD2 anticorps (Middle Region)

N° du produit ABIN632104

Détail du produit anti-ASPHD2 anticorps

Antigène: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASPHD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASPHD2 antibody was raised against the middle region of ASPHD2

Purification: Affinity purified

Immunogène: ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASPHD2 Blocking Peptide, catalog no. 33R-10060, is also available for use as a blocking control in assays to test for specificity of this ASPHD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASPHD2

Antigène: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Autre désignation: ASPHD2 (ASPHD2 Produits)

Synonymes: anticorps 2900006N09Rik, anticorps 9230106G13Rik, anticorps RGD1306020, anticorps zgc:153516, anticorps aspartate beta-hydroxylase domain containing 2, anticorps ASPHD2, anticorps asphd2, anticorps Asphd2

Sujet: The function of ASPH protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)